PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013599910.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Trihelix
Protein Properties Length: 394aa    MW: 45215.6 Da    PI: 7.4996
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013599910.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix85.28.1e-2776157286
        trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     W ++e++ Li +rr m+  ++++k++k+lWe++s+kmre+gf rsp++C++kw+nl k++kk k++++++   +s +++y++++e
  XP_013599910.1  76 WVQDETRSLIMFRRGMDGLFNTSKSNKHLWEQISAKMREKGFDRSPTMCTDKWRNLLKEFKKAKHRDRGN---RSAKMSYYKEIE 157
                     ********************************************************************95...566899***997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.9E-466137IPR009057Homeodomain-like
PROSITE profilePS500907.97968132IPR017877Myb-like domain
SMARTSM007170.009672134IPR001005SANT/Myb domain
CDDcd122031.42E-2974139No hitNo description
PfamPF138373.6E-2075159No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MFVSDKPRPI DFYKDDNTTT TTARDNMIID VTTNTPGRDL HPHHHHHHLQ PQQILLGESS  60
GEDHEVKAPK KRAETWVQDE TRSLIMFRRG MDGLFNTSKS NKHLWEQISA KMREKGFDRS  120
PTMCTDKWRN LLKEFKKAKH RDRGNRSAKM SYYKEIEEIL RERSKKVTAT GQYSKSPNAT  180
ATAKVDSFMQ FTDKGFDDPS ISFGSVEANG RPALNLERRL DHDGHPLAIA TVDVVAANGV  240
PPWNWRETPG NGGDSHGQPF GGRVITVKFG DYTRRIGVDG STEAIKDTIR SAFGLRTRRA  300
FWLEDEDQVV RCLDRDMPLG NYLLHVDDGL AIRVCHYDES NQLPVHTEEK VFYTEEDYRD  360
FLARRGWTCL QFDGFRNIDN MDDLQPGAVY RGVR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A2e-5370155186DNA binding protein GT-1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00004PBMTransfer from 920224Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013599910.10.0PREDICTED: trihelix transcription factor GT-1-like isoform X1
SwissprotQ9FX530.0TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLA0A0D3DXJ00.0A0A0D3DXJ0_BRAOL; Uncharacterized protein
STRINGBra026903.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28912768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13450.10.0Trihelix family protein